PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.353120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 281aa    MW: 31506.7 Da    PI: 8.9317
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.353120.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
   Cucsa.353120.1 14 KGPWSPEEDMKLKSYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.31.5e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd+++  +    G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.353120.1  69 GDFSEEEDKIICSLYVSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.484962IPR017930Myb domain
SuperFamilySSF466892.74E-2711109IPR009057Homeodomain-like
SMARTSM007176.6E-131364IPR001005SANT/Myb domain
PfamPF002495.4E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-251569IPR009057Homeodomain-like
CDDcd001673.56E-101662No hitNo description
PROSITE profilePS5129422.12263117IPR017930Myb domain
SMARTSM007172.2E-1167115IPR001005SANT/Myb domain
PfamPF002492.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2470117IPR009057Homeodomain-like
CDDcd001674.03E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDMKLKSYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDKIIC SLYVSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
HYEKQQQQLA RRGRKIKSGI GNSMAIVFDN QGIYNNNNNN NQSPFLPELS PALNSPPPPP  180
YASYQPLQFP SNSFSHTAGV IDDLRRTDSV LRFGMEGASS QPVTSYHVGE LEKVVYSNTP  240
SFDDGLQFSC DNNGLNLMND LDWGEMSSLI SAPLYPSMII *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141414.10.0PREDICTED: transcription factor RAX1-like
SwissprotQ9FKL22e-80MYB36_ARATH; Transcription factor MYB36
STRINGPOPTR_0002s11440.15e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-80myb domain protein 84